Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SATB1 Rabbit Polyclonal Antibody (HRP)

SATB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DEFDA, KTZSL

UniProt

Q01826

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SATB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002962

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit
MBS7233438-01 48 Well

Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit
MBS7233438-02 96 Well

Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit
MBS7233438-03 5x 96 Well

Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit
MBS7233438-04 10x 96 Well

Guinea pig Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (SCYE1) ELISA Kit

Sign In for Pricing
View Details
Odf2 (NM_001113213) Mouse Tagged ORF Clone Lentiviral Particle
MR210835L3V 200 µL

Odf2 (NM_001113213) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SPG21 siRNA Oligos set (Human)
45290171 3x 5 nmol

SPG21 siRNA Oligos set (Human)

Sign In for Pricing
View Details