Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36L1 Rabbit Polyclonal Antibody (FITC)

ZFP36L1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B

UniProt

Q07352

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMC8 Antibody, FITC conjugated
A17918-100UG 100 µg

EMC8 Antibody, FITC conjugated

Sign In for Pricing
View Details
Monkey Olfactory receptor 8K3 (OR8K3) ELISA Kit
GTR10365624 96 Well

Monkey Olfactory receptor 8K3 (OR8K3) ELISA Kit

Sign In for Pricing
View Details
Emid2 3'UTR GFP Stable Cell Line
TU155792 1.0 mL

Emid2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband® (monoclonal, 6H7), PE Conjugate
M01141-1-PE 100 µg/Vial

Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband® (monoclonal, 6H7), PE Conjugate

Sign In for Pricing
View Details
4932441B19Rik Protein Vector (Mouse) (pPB-C-His)
PV149626 500 ng

4932441B19Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Fam126a sgRNA CRISPR Lentivector (Rat) (Target 2)
K6193603 1.0 µg DNA

Fam126a sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details