Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36L1 Rabbit Polyclonal Antibody (HRP)

ZFP36L1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B

UniProt

Q07352

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PPP2CB shRNA Plasmid
abx972174-01 150 µg

Mouse PPP2CB shRNA Plasmid

Sign In for Pricing
View Details
Mouse PPP2CB shRNA Plasmid
abx972174-02 300 µg

Mouse PPP2CB shRNA Plasmid

Sign In for Pricing
View Details
MEK Kinase Kinase 5 (MAP4K5) Antibody
abx234984 100 µg

MEK Kinase Kinase 5 (MAP4K5) Antibody

Sign In for Pricing
View Details
LYVE1 Peptide - C-terminal region
MBS3244634-01 0.1 mg

LYVE1 Peptide - C-terminal region

Sign In for Pricing
View Details
LYVE1 Peptide - C-terminal region
MBS3244634-02 5x 0.1 mg

LYVE1 Peptide - C-terminal region

Sign In for Pricing
View Details
Mouse PRKD3 siRNA
abx929785-01 15 nmol

Mouse PRKD3 siRNA

Sign In for Pricing
View Details