Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFP36L1 Rabbit Polyclonal Antibody (Biotin)

ZFP36L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BRF1, ERF1, cMG1, ERF-1, Berg36, TIS11B, RNF162B

UniProt

Q07352

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP36L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004917

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP48 siRNA (Human)
CRJ3348-01 15 nmol

USP48 siRNA (Human)

Sign In for Pricing
View Details
USP48 siRNA (Human)
CRJ3348-02 30 nmol

USP48 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal PSMA4 Antibody [Alexa Fluor 405]
NBP2-99610AF405 0.1 mL

Rabbit Polyclonal PSMA4 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
TBCE (NM_001079515) Human Recombinant Protein
E45H36226M5 20 µg

TBCE (NM_001079515) Human Recombinant Protein

Sign In for Pricing
View Details
REG1A Monoclonal Antibody
AN200210P 100 µL

REG1A Monoclonal Antibody

Sign In for Pricing
View Details
ZNF426 CRISPR Knock Out 293T Cell Line (Human)
51513141 1x 10^6 Cells / 1.0 mL

ZNF426 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details