Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT5H Rabbit Polyclonal Antibody (HRP)

SUPT5H Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPT5, SPT5H, Tat-CT1

UniProt

O00267

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SUPT5H

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PYAAPSPQGSYQPSPSPQSYHQVAPSPAGYQNTHSPASYHPTPSPMAYQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

121kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003160

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein
abx166647-01 10 µg

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein
abx166647-02 50 µg

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein
abx166647-03 100 µg

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein
abx166647-04 200 µg

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein

Sign In for Pricing
View Details
Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein
abx166647-05 500 µg

Human Glutamate Cysteine Ligase, Modifier Subunit (GCLM) Protein

Sign In for Pricing
View Details
3-Bromopyridine-4-boronic acid pinacol ester
MBS9025142-01 1 g

3-Bromopyridine-4-boronic acid pinacol ester

Sign In for Pricing
View Details