Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT6H Rabbit Polyclonal Antibody (HRP)

SUPT6H Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPT6, SPT6H, emb-5

UniProt

Q7KZ85

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUPT6H

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSPY2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2543506 1.0 µg DNA

TSPY2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Anti-PCNA antibody (Mouse mAb)
GB15010-50 50 μL

Recombinant Anti-PCNA antibody (Mouse mAb)

Sign In for Pricing
View Details
RPL13AP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
40816111 3x 1.0 µg

RPL13AP2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Dibenzo[de, qr]naphthacene-9,14-dione
446587-01 1 mg

Dibenzo[de, qr]naphthacene-9,14-dione

Sign In for Pricing
View Details
Dibenzo[de, qr]naphthacene-9,14-dione
446587-02 2.5 mg

Dibenzo[de, qr]naphthacene-9,14-dione

Sign In for Pricing
View Details
H.pylori Antibody Rapid Test Device – WB/S/P
D-HPD40 40 Tests

H.pylori Antibody Rapid Test Device – WB/S/P

Sign In for Pricing
View Details