Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT6H Rabbit Polyclonal Antibody (Biotin)

SUPT6H Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SPT6, SPT6H, emb-5

UniProt

Q7KZ85

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human SUPT6H

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FVESEAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Xylene mixed isomers 98.5% (plus ethylbenzene)
X00360 500 mL

Xylene mixed isomers 98.5% (plus ethylbenzene)

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 193
orb3135409-01 50 mg

E3 Ligase Ligand-linker Conjugate 193

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 193
orb3135409-02 10 mg

E3 Ligase Ligand-linker Conjugate 193

Sign In for Pricing
View Details
Hamster soluble Vascular cell adhesion molecule 1, sVCAM-1 ELISA Kit
MBS1604145-01 48 Well

Hamster soluble Vascular cell adhesion molecule 1, sVCAM-1 ELISA Kit

Sign In for Pricing
View Details
Hamster soluble Vascular cell adhesion molecule 1, sVCAM-1 ELISA Kit
MBS1604145-02 96 Well

Hamster soluble Vascular cell adhesion molecule 1, sVCAM-1 ELISA Kit

Sign In for Pricing
View Details
Hamster soluble Vascular cell adhesion molecule 1, sVCAM-1 ELISA Kit
MBS1604145-03 5x 96 Well

Hamster soluble Vascular cell adhesion molecule 1, sVCAM-1 ELISA Kit

Sign In for Pricing
View Details