Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF2 Rabbit Polyclonal Antibody (HRP)

TAF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRT40, TAF2B, CIF150, TAFII150

UniProt

Q6P1X5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TAF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

137kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

ChIP, WB

NCBI Accession Number

NP_003175

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LED Lights Observation Windows
SPC1000-OPT 1 Each

LED Lights Observation Windows

Sign In for Pricing
View Details
Lentiviral human AMBP shRNA (UAS) - Lentiviral human AMBP shRNA (UAS) (100)
GTR15081954 1 Vial

Lentiviral human AMBP shRNA (UAS) - Lentiviral human AMBP shRNA (UAS) (100)

Sign In for Pricing
View Details
CAMKMT Human Pre-designed siRNA Set A
HY-RS01867 1 Set

CAMKMT Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Anti-FLT1 monoclonal antibody, clone TZ10-10
CABT-L607 100 ul

Rabbit Anti-FLT1 monoclonal antibody, clone TZ10-10

Sign In for Pricing
View Details
Recombinant Human TIMP2, None tagged
TIMP2-3835H 20 µg

Recombinant Human TIMP2, None tagged

Sign In for Pricing
View Details
PSME1 (Proteasome Activator Complex Subunit 1, PA28A, IFI5111, REGalpha, PA28alpha) (MaxLight 650)
MBS6433764-01 0.1 mL

PSME1 (Proteasome Activator Complex Subunit 1, PA28A, IFI5111, REGalpha, PA28alpha) (MaxLight 650)

Sign In for Pricing
View Details