Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX5 Rabbit Polyclonal Antibody (HRP)

TBX5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HOS

UniProt

Q99593

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Catenin Recombinant Rabbit monoclonal Antibody
IRS061 100 µL

Beta Catenin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF647 conjugate, 0.1mg/mL
BNC470688-500 1x 500 µL

Cytokeratin 8 (C-43), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKAP12 Human Gene Knockout Kit (CRISPR)
KN214439LP 1 Kit

AKAP12 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IDH3G Polyclonal Antibody
E-AB-14638-01 20 µL

IDH3G Polyclonal Antibody

Sign In for Pricing
View Details
IDH3G Polyclonal Antibody
E-AB-14638-02 60 µL

IDH3G Polyclonal Antibody

Sign In for Pricing
View Details
IDH3G Polyclonal Antibody
E-AB-14638-03 120 µL

IDH3G Polyclonal Antibody

Sign In for Pricing
View Details