Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBX5 Rabbit Polyclonal Antibody (Biotin)

TBX5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HOS

UniProt

Q99593

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TBX5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NSMHKYQPRLHIVKADENNGFGSKNTAFCTHVFPETAFIAVTSYQNHKIT

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542448

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Snap-together conical tube Racks, for 15mI tubes and 50mI tubes, color: Orange
BR-81500 1 Each

Snap-together conical tube Racks, for 15mI tubes and 50mI tubes, color: Orange

Sign In for Pricing
View Details
Purified Anti-Human CD192 Antibody[K036C2]
E-AB-F1385A-01 25 µg

Purified Anti-Human CD192 Antibody[K036C2]

Sign In for Pricing
View Details
Purified Anti-Human CD192 Antibody[K036C2]
E-AB-F1385A-02 100 µg

Purified Anti-Human CD192 Antibody[K036C2]

Sign In for Pricing
View Details
Human Myosin Light Chain Kinase 3 (MYLK3) Antibody Pair Kit (with Standard)
MBS2102508-01 5x 96 Tests

Human Myosin Light Chain Kinase 3 (MYLK3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Myosin Light Chain Kinase 3 (MYLK3) Antibody Pair Kit (with Standard)
MBS2102508-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Myosin Light Chain Kinase 3 (MYLK3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Myosin Light Chain Kinase 3 (MYLK3) Antibody Pair Kit (with Standard)
MBS2102508-03 10x 96 Tests

Human Myosin Light Chain Kinase 3 (MYLK3) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details