Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF19 Rabbit Polyclonal Antibody (HRP)

TCF19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SC1, TCF-19

UniProt

Q9Y242

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009040

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Selenous (Selenous) Acid, ≥97% discontinued. See S0658
241952-01 25 g

Selenous (Selenous) Acid, ≥97% discontinued. See S0658

Sign In for Pricing
View Details
Selenous (Selenous) Acid, ≥97% discontinued. See S0658
241952-02 100 g

Selenous (Selenous) Acid, ≥97% discontinued. See S0658

Sign In for Pricing
View Details
Selenous (Selenous) Acid, ≥97% discontinued. See S0658
241952-03 250 g

Selenous (Selenous) Acid, ≥97% discontinued. See S0658

Sign In for Pricing
View Details
Selenous (Selenous) Acid, ≥97% discontinued. See S0658
241952-04 1 Kg

Selenous (Selenous) Acid, ≥97% discontinued. See S0658

Sign In for Pricing
View Details
CD337/NCR3 Mouse Monoclonal Antibody
orb2975110-01 50 µg

CD337/NCR3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
CD337/NCR3 Mouse Monoclonal Antibody
orb2975110-02 100 µg

CD337/NCR3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details