Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tead4 Rabbit Polyclonal Antibody (HRP)

Tead4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Tef, Etfr, Rtef, Tef3, Tefr, ETFR-, Etfr2, FR-19, Rtef1, TEAD-, TEF-3, Tefr1, ETFR-2, TEAD-4, Tcf13r, Tefr1a, Tcf13r1

UniProt

Q62296

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRKAREIQAKLKDQAAKNKALQSMAAMSSAQIVSATAFHSKMALARGPGY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035697

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mark4 (NM_172279) Mouse Tagged ORF Clone Lentiviral Particle
MR215461L4V 200 µL

Mark4 (NM_172279) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tripeptidyl peptidase II/TPPII/TPP2 Rabbit Polyclonal Antibody (Fluoro647)
orb3101435 100 µg

Tripeptidyl peptidase II/TPPII/TPP2 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
TS-50.80-514-RD-RL Floor & Pavement Marking Tapes
104313 1 Pack (1 Roll x 1 Pack)

TS-50.80-514-RD-RL Floor & Pavement Marking Tapes

Sign In for Pricing
View Details
CPN reg (h) -PR
sc-40427-PR 10 µM - 20 µL

CPN reg (h) -PR

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 18 Antibody (KRT18/2808R) [mFluor Violet 500 SE]
NBP3-08634MFV500 0.1 mL

Rabbit Monoclonal Cytokeratin 18 Antibody (KRT18/2808R) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ITGB3 Polyclonal Antibody
RD82673A-01 60 μL

ITGB3 Polyclonal Antibody

Sign In for Pricing
View Details