Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP4 Rabbit Polyclonal Antibody (FITC)

TFAP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AP-4, bHLHc41

UniProt

Q01664

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEEQRRAVIVKPVRSCPEAPTSDTASDSEASDSDAMDQSREEPSGDGELP

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003214

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)
MBS2147680-01 0.1 mL

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)
MBS2147680-02 0.2 mL

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)
MBS2147680-03 0.5 mL

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)
MBS2147680-04 1 mL

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)
MBS2147680-05 5 mL

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)
MBS2147680-06 5x 5 mL

APC-Linked Monoclonal Antibody to S100 CalcuM Binding Protein A12 (S100A12)

Sign In for Pricing
View Details