Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP2 Rabbit Polyclonal Antibody (FITC)

TFDP2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DP2

UniProt

Q14188

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TFDP2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_006277

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csnk1e 3'UTR Luciferase Stable Cell Line
TU202864 1.0 mL

Csnk1e 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit
MBS2613208-01 48 Well

Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit

Sign In for Pricing
View Details
Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit
MBS2613208-02 96 Well

Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit

Sign In for Pricing
View Details
Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit
MBS2613208-03 5x 96 Well

Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit

Sign In for Pricing
View Details
Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit
MBS2613208-04 10x 96 Well

Rabbit LPS-responsive vesicle trafficking, beach and anchor containing (LRBA) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ZFP91 Antibody
NBP1-80863-25ul 25 µL

Rabbit Polyclonal ZFP91 Antibody

Sign In for Pricing
View Details