Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TGFB1I1 Rabbit Polyclonal Antibody (FITC)

TGFB1I1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HIC5, ARA55, HIC-5, TSC-5

UniProt

B2R8D5

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human TGFB1I1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_057011

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SARS2 Antibody Picoband® Fluoro647 Conjugated
A08425-1-Fluoro647 100 µg/Vial

Anti-SARS2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)
MBS2055942-01 0.1 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)
MBS2055942-02 0.2 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)
MBS2055942-03 0.5 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)
MBS2055942-04 1 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)
MBS2055942-05 5 mL

HRP-Linked Polyclonal Antibody to Protein Disulfide Isomerase A2 (PDIA2)

Sign In for Pricing
View Details