Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP1 Rabbit Polyclonal Antibody (FITC)

TULP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP14, LCA15, TUBL1

UniProt

O00294

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TULP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEEEAATVIKKSNQKGKAKGKGKKKAKEERAPSPPVEVDEPREFVLRPAP

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_003313

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (MaxLight 550) discontinued
044091-ML550 100 µL

ZKSCAN4, CT (ZKSCAN4, ZNF307, ZNF427, Zinc finger protein with KRAB and SCAN domains 4, P373c6.1, Zinc finger protein 307, Zinc finger protein 427) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FAS Monoclonal Antibody
MBS9400005-01 0.1 mL

FAS Monoclonal Antibody

Sign In for Pricing
View Details
FAS Monoclonal Antibody
MBS9400005-02 5x 0.1 mL

FAS Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica UDP-arabinopyranose mutase 1 (UAM1)
MBS1316743-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica UDP-arabinopyranose mutase 1 (UAM1)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica UDP-arabinopyranose mutase 1 (UAM1)
MBS1316743-02 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica UDP-arabinopyranose mutase 1 (UAM1)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica UDP-arabinopyranose mutase 1 (UAM1)
MBS1316743-03 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica UDP-arabinopyranose mutase 1 (UAM1)

Sign In for Pricing
View Details