Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USF2 Rabbit Polyclonal Antibody (HRP)

USF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FIP, bHLHb12

UniProt

Q15853

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human USF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003358

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Desmogleins 1, Dsg-1 Elisa Kit
EKC33446 96 Tests

Human Desmogleins 1, Dsg-1 Elisa Kit

Sign In for Pricing
View Details
DNAI1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV661625 1.0 µg DNA

DNAI1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
FNBP1L Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2540380 100 µL

FNBP1L Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
DVL2 (Segment polarity Protein dishevelled homolog DVL-2)
333618-01 50 µL

DVL2 (Segment polarity Protein dishevelled homolog DVL-2)

Sign In for Pricing
View Details
DVL2 (Segment polarity Protein dishevelled homolog DVL-2)
333618-02 100 µL

DVL2 (Segment polarity Protein dishevelled homolog DVL-2)

Sign In for Pricing
View Details
Phospho-DDR1 (panTyr) Matched Antibody Pair
CST 89856S 1 Kit

Phospho-DDR1 (panTyr) Matched Antibody Pair

Sign In for Pricing
View Details