Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USF2 Rabbit Polyclonal Antibody (Biotin)

USF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FIP, bHLHb12

UniProt

Q15853

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human USF2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003358

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATM (Glycine Amidinotransferase, Mitochondrial, AT, AGAT, CCDS3) (AP)
MBS6446712-01 0.1 mL

GATM (Glycine Amidinotransferase, Mitochondrial, AT, AGAT, CCDS3) (AP)

Sign In for Pricing
View Details
GATM (Glycine Amidinotransferase, Mitochondrial, AT, AGAT, CCDS3) (AP)
MBS6446712-02 5x 0.1 mL

GATM (Glycine Amidinotransferase, Mitochondrial, AT, AGAT, CCDS3) (AP)

Sign In for Pricing
View Details
Anti Mouse CD90.2 Flow Cytometry Monoclonal Clone 30H12 APC Ready To Use 100 Tests
IRTAMSCD90230H12CAPC100 100 Tests

Anti Mouse CD90.2 Flow Cytometry Monoclonal Clone 30H12 APC Ready To Use 100 Tests

Sign In for Pricing
View Details
PCDHB1 Rabbit pAb, AE conjugated
orb2888277 100 µL

PCDHB1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Anti-Clostridium botulinum botA/BoNT Antibody (1F3)
JN888243-01 50 µg

Anti-Clostridium botulinum botA/BoNT Antibody (1F3)

Sign In for Pricing
View Details
Anti-Clostridium botulinum botA/BoNT Antibody (1F3)
JN888243-02 1 mg

Anti-Clostridium botulinum botA/BoNT Antibody (1F3)

Sign In for Pricing
View Details