Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Utx Rabbit Polyclonal Antibody (HRP)

Utx Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Utx

UniProt

O70546

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATILQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

154kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_033509

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caprisil C18-IP HPLC Column, 5 µm, 100 Å, CD555-C18-IP x 200 mm
CD455-C18-IP 5 µm

Caprisil C18-IP HPLC Column, 5 µm, 100 Å, CD555-C18-IP x 200 mm

Sign In for Pricing
View Details
DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14) (MaxLight 550)
125945-ML550 100 µL

DNAJC19 (Mitochondrial Import Inner Membrane Translocase Subunit TIM14, DnaJ Homolog Subfamily C Member 19, TIMM14, TIM14) (MaxLight 550)

Sign In for Pricing
View Details
GBE1 Rabbit pAb, AP conjugated
orb2877606 100 µL

GBE1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Snx10 ORF Vector (Rat) (pORF)
ORF076783 1.0 µg DNA

Snx10 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MYH4 Specific Rabbit Polyclonal Antibody
orb395325-01 50 µg

MYH4 Specific Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYH4 Specific Rabbit Polyclonal Antibody
orb395325-02 100 µg

MYH4 Specific Rabbit Polyclonal Antibody

Sign In for Pricing
View Details