Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt8b Rabbit Polyclonal Antibody (HRP)

Wnt8b Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9WUD6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035850

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATC4 discontinued
392157-01 20 µL

NFATC4 discontinued

Sign In for Pricing
View Details
NFATC4 discontinued
392157-02 200 µL

NFATC4 discontinued

Sign In for Pricing
View Details
Stable Human ER Positive Breast Epithelial Cell Line
T6021 1x106 cells / 1.0 mL

Stable Human ER Positive Breast Epithelial Cell Line

Sign In for Pricing
View Details
Anti-XRN2 Antibody Picoband® Fluoro488 Conjugated
A02797-3-Fluoro488 100 µg/Vial

Anti-XRN2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Discs, Large Homolog 1 (DLG1), Recombinant, Rat, His-Tag
050844-01 10 µg

Discs, Large Homolog 1 (DLG1), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
Discs, Large Homolog 1 (DLG1), Recombinant, Rat, His-Tag
050844-02 50 µg

Discs, Large Homolog 1 (DLG1), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details