Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT8B Rabbit Polyclonal Antibody (FITC)

WNT8B Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q93098

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WNT8B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAG

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003384

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SARS2 NSP5/3CL-PRO/M Pro Protein, N-His
orb3056040-01 50 µg

Recombinant SARS2 NSP5/3CL-PRO/M Pro Protein, N-His

Sign In for Pricing
View Details
Recombinant SARS2 NSP5/3CL-PRO/M Pro Protein, N-His
orb3056040-02 100 µg

Recombinant SARS2 NSP5/3CL-PRO/M Pro Protein, N-His

Sign In for Pricing
View Details
Recombinant SARS2 NSP5/3CL-PRO/M Pro Protein, N-His
orb3056040-03 1 mg

Recombinant SARS2 NSP5/3CL-PRO/M Pro Protein, N-His

Sign In for Pricing
View Details
Recombinant Human Noggin
FY-PN53187 50 µg

Recombinant Human Noggin

Sign In for Pricing
View Details
Human GATA Binding Protein 5 (GATA5) ELISA Kit
orb778867-01 48 Tests

Human GATA Binding Protein 5 (GATA5) ELISA Kit

Sign In for Pricing
View Details
Human GATA Binding Protein 5 (GATA5) ELISA Kit
orb778867-02 96 Tests

Human GATA Binding Protein 5 (GATA5) ELISA Kit

Sign In for Pricing
View Details