Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFY Rabbit Polyclonal Antibody (Biotin)

ZFY Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF911

UniProt

P08048

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZFY

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RPSELKKHVAVHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_006724936

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Orm3 (NM_013623) Mouse Tagged ORF Clone Lentiviral Particle
MR215822L4V 200 µL

Orm3 (NM_013623) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MRPS23 CytoSection
TS400014P5 25 Slides

MRPS23 CytoSection

Sign In for Pricing
View Details
RNF115 Rabbit mAb
E51A08668 100 µL

RNF115 Rabbit mAb

Sign In for Pricing
View Details
Mouse Creatine Kinase, Brain (CKB) ELISA Kit
DLR-CKB-Mu-96T 96 Tests

Mouse Creatine Kinase, Brain (CKB) ELISA Kit

Sign In for Pricing
View Details
NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (PE)
MBS6387270-01 0.1 mL

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (PE)

Sign In for Pricing
View Details
NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (PE)
MBS6387270-02 5x 0.1 mL

NOS1AP (CAPON, KIAA0464, Carboxyl-terminal PDZ Ligand Of Neuronal Nitric Oxide Synthase Protein, C-terminal PDZ Ligand of Neuronal Nitric Oxide Synthase Protein, Nitric Oxide Synthase 1 Adaptor Protein) (PE)

Sign In for Pricing
View Details