Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF7 Rabbit Polyclonal Antibody (HRP)

ZNF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KOX4, zf30, HF.16

UniProt

Q8N8Y4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPWVLDLQGAEGTEAPRTSKTDSTIRTENEQACEDMDILKSESYGTVVRI

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_003407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL1F10 Antibody Picoband® (APC Conjugate)
A09268-2-APC 100 µg/Vial

Anti-IL1F10 Antibody Picoband® (APC Conjugate)

Sign In for Pricing
View Details
Synapsin I (Phospho-Ser553) Antibody
MBS9508547-01 0.05 mL

Synapsin I (Phospho-Ser553) Antibody

Sign In for Pricing
View Details
Synapsin I (Phospho-Ser553) Antibody
MBS9508547-02 0.1 mL

Synapsin I (Phospho-Ser553) Antibody

Sign In for Pricing
View Details
Synapsin I (Phospho-Ser553) Antibody
MBS9508547-03 5x 0.1 mL

Synapsin I (Phospho-Ser553) Antibody

Sign In for Pricing
View Details
Rabbit anti-human Ubiquitin-conjugating enzyme E2 D1 polyclonal Antibody(UBE2D1), HRP conjugated
MBS1492810-01 0.05 mg

Rabbit anti-human Ubiquitin-conjugating enzyme E2 D1 polyclonal Antibody(UBE2D1), HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Ubiquitin-conjugating enzyme E2 D1 polyclonal Antibody(UBE2D1), HRP conjugated
MBS1492810-02 0.1 mg

Rabbit anti-human Ubiquitin-conjugating enzyme E2 D1 polyclonal Antibody(UBE2D1), HRP conjugated

Sign In for Pricing
View Details