Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF8 Rabbit Polyclonal Antibody (Biotin)

ZNF8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HF.18, Zfp128

UniProt

P17098

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TQEEWGQLDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGTELW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_066575

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (PE)
MBS6482994-01 0.1 mL

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (PE)

Sign In for Pricing
View Details
Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (PE)
MBS6482994-02 5x 0.1 mL

Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (PE)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein F3 (IQCF3)
MBS951685-01 0.02 mg (E-Coli)

Recombinant Human IQ domain-containing protein F3 (IQCF3)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein F3 (IQCF3)
MBS951685-02 0.1 mg (E-Coli)

Recombinant Human IQ domain-containing protein F3 (IQCF3)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein F3 (IQCF3)
MBS951685-03 0.02 mg (Yeast)

Recombinant Human IQ domain-containing protein F3 (IQCF3)

Sign In for Pricing
View Details
Recombinant Human IQ domain-containing protein F3 (IQCF3)
MBS951685-04 0.1 mg (Yeast)

Recombinant Human IQ domain-containing protein F3 (IQCF3)

Sign In for Pricing
View Details