Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF18 Rabbit Polyclonal Antibody (HRP)

ZNF18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HDSG1, KOX11, ZNF535, Zfp535, ZKSCAN6, ZSCAN38

UniProt

P17022

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLGQALGLLPSLAKAEDSQFSESDAALQEELSSPETARQLFRQFRYQVMS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653281

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1R2 Matched ELISA Antibody Pair Set, Human
MBS8118186-01 5 Plates

IL1R2 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
IL1R2 Matched ELISA Antibody Pair Set, Human
MBS8118186-02 15 Plates

IL1R2 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
IL1R2 Matched ELISA Antibody Pair Set, Human
MBS8118186-03 5x 15 Plates

IL1R2 Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
MRP-L51 discontinued
391735 200 µL

MRP-L51 discontinued

Sign In for Pricing
View Details
Sodium Metabisulphite Extra Pure
1191100 500 500 g

Sodium Metabisulphite Extra Pure

Sign In for Pricing
View Details
CFD siRNA (Rat)
MBS8240779-01 15 nmol

CFD siRNA (Rat)

Sign In for Pricing
View Details