Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF24 Rabbit Polyclonal Antibody (HRP)

ZNF24 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191

UniProt

P17028

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF24

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PKSH030447-01 100 µg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human EpCAM/TROP-1 Protein (His Tag)
PKSH030447-02 1 mg

Recombinant Human EpCAM/TROP-1 Protein (His Tag)

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF640R conjugate, 0.1mg/mL
BNC403132-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/3132R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant N Cadherin Monoclonal Antibody
AN300983L-01 50 µL

Recombinant N Cadherin Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant N Cadherin Monoclonal Antibody
AN300983L-02 100 µL

Recombinant N Cadherin Monoclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 1A1/1A2 (MC1), CF405S conjugate, 0.1mg/mL
BNC042907-100 1x 100 µL

Cytochrome P450 1A1/1A2 (MC1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details