Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF24 Rabbit Polyclonal Antibody (Biotin)

ZNF24 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX17, RSG-A, ZNF191, ZSCAN3, Zfp191

UniProt

P17028

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF24

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFR

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCT Protein Vector (Human) (pPB-C-His)
PV011793 500 ng

DCT Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
CDC20B (NM_152623) Human Over-expression Lysate
E45H14626-2 20 µg

CDC20B (NM_152623) Human Over-expression Lysate

Sign In for Pricing
View Details
Olr1664 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7374707 1.0 µg DNA

Olr1664 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Carboxy Methyl Cellulose Sodium Salt ACS High Viscosity (1100-1900)
044425-01 25 Kg

Carboxy Methyl Cellulose Sodium Salt ACS High Viscosity (1100-1900)

Sign In for Pricing
View Details
Carboxy Methyl Cellulose Sodium Salt ACS High Viscosity (1100-1900)
044425-02 100 g

Carboxy Methyl Cellulose Sodium Salt ACS High Viscosity (1100-1900)

Sign In for Pricing
View Details
Carboxy Methyl Cellulose Sodium Salt ACS High Viscosity (1100-1900)
044425-03 500 g

Carboxy Methyl Cellulose Sodium Salt ACS High Viscosity (1100-1900)

Sign In for Pricing
View Details