Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zkscan1 Rabbit Polyclonal Antibody (Biotin)

Zkscan1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX1, KOX18, C87323, PHZ-37, ZNF139, AI646829, AI788588, 5930429A01Rik, 9130423L19Rik, 9230118B16Rik

UniProt

Q8BGS3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YECNECGKAFSQSSDLTKHQRIHTGEKPYECSECGKAFNRNSYLILHRRI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_084145

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HEC1 Rabbit Monoclonal Antibody
MA2979-.05 50 µL

Anti-HEC1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
USP13 Rabbit Monoclonal Antibody [Clone ID: 23GB4250]
TA425312 100 µL

USP13 Rabbit Monoclonal Antibody [Clone ID: 23GB4250]

Sign In for Pricing
View Details
Sipa1l1 Rat shRNA Plasmid (Locus ID 246212)
TR713052 1 Kit

Sipa1l1 Rat shRNA Plasmid (Locus ID 246212)

Sign In for Pricing
View Details
Apolipoprotein A4 (APOA4) Magnetic Fluorescence Assay Kit
MBS2158107-01 96 Tests

Apolipoprotein A4 (APOA4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Apolipoprotein A4 (APOA4) Magnetic Fluorescence Assay Kit
MBS2158107-02 5x 96 Tests

Apolipoprotein A4 (APOA4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Apolipoprotein A4 (APOA4) Magnetic Fluorescence Assay Kit
MBS2158107-03 10x 96 Tests

Apolipoprotein A4 (APOA4) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details