Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF37A Rabbit Polyclonal Antibody (HRP)

ZNF37A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KOX21, ZNF37

UniProt

P17032

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF37A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSFSEKSTLTKHL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_003412

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smox ORF Vector (Mouse) (pORF)
ORF058006 1.0 µg DNA

Smox ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
QRSL1, NT (QRSL1, Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial, Glutaminyl-tRNA synthase-like protein 1) (APC)
MBS6339460-01 0.2 mL

QRSL1, NT (QRSL1, Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial, Glutaminyl-tRNA synthase-like protein 1) (APC)

Sign In for Pricing
View Details
QRSL1, NT (QRSL1, Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial, Glutaminyl-tRNA synthase-like protein 1) (APC)
MBS6339460-02 5x 0.2 mL

QRSL1, NT (QRSL1, Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial, Glutaminyl-tRNA synthase-like protein 1) (APC)

Sign In for Pricing
View Details
PMS2 Polyclonal Antibody
orb3149451-01 50 µg

PMS2 Polyclonal Antibody

Sign In for Pricing
View Details
PMS2 Polyclonal Antibody
orb3149451-02 100 µg

PMS2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pectobacterium carotovorum subsp. carotovorum Flagellar biosynthetic protein fliP (fliP)
MBS7014897-01 0.02 mg

Recombinant Pectobacterium carotovorum subsp. carotovorum Flagellar biosynthetic protein fliP (fliP)

Sign In for Pricing
View Details