Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF37A Rabbit Polyclonal Antibody (Biotin)

ZNF37A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX21, ZNF37

UniProt

P17032

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF37A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNECGKSFSEKSTLTKHL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_003412

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Anti-Human IgG (H&L) - Alexa Fluor 555
MBS4516941-01 0.1 mL

Goat Anti-Human IgG (H&L) - Alexa Fluor 555

Sign In for Pricing
View Details
Goat Anti-Human IgG (H&L) - Alexa Fluor 555
MBS4516941-02 0.5 mL

Goat Anti-Human IgG (H&L) - Alexa Fluor 555

Sign In for Pricing
View Details
Goat Anti-Human IgG (H&L) - Alexa Fluor 555
MBS4516941-03 1 mL

Goat Anti-Human IgG (H&L) - Alexa Fluor 555

Sign In for Pricing
View Details
Goat Anti-Human IgG (H&L) - Alexa Fluor 555
MBS4516941-04 5x 1 mL

Goat Anti-Human IgG (H&L) - Alexa Fluor 555

Sign In for Pricing
View Details
Monkey Optineurin ELISA Kit
MBS064528-01 48 Well

Monkey Optineurin ELISA Kit

Sign In for Pricing
View Details
Monkey Optineurin ELISA Kit
MBS064528-02 96 Well

Monkey Optineurin ELISA Kit

Sign In for Pricing
View Details