Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIK3R3 Rabbit Polyclonal Antibody (FITC)

PIK3R3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P55, p55PIK, p55-GAMMA

UniProt

Q92569

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PIK3R3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003620

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf49 Antibody - middle region : Biotin (ARP53291_P050-Biotin)
ARP53291_P050-Biotin 100 µL

C17orf49 Antibody - middle region : Biotin (ARP53291_P050-Biotin)

Sign In for Pricing
View Details
PRHOXNB Protein Vector (Human) (pPM-C-His)
PV113161 500 ng

PRHOXNB Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
CHRNB1 (Cholinergic Receptor, Nicotinic, beta (muscle), ACHRB, Acetylcholine Receptor Subunit beta, CHRNB, CMS1D, CMS2A, SCCMS) (MaxLight 550)
MBS6411664-01 0.1 mL

CHRNB1 (Cholinergic Receptor, Nicotinic, beta (muscle), ACHRB, Acetylcholine Receptor Subunit beta, CHRNB, CMS1D, CMS2A, SCCMS) (MaxLight 550)

Sign In for Pricing
View Details
CHRNB1 (Cholinergic Receptor, Nicotinic, beta (muscle), ACHRB, Acetylcholine Receptor Subunit beta, CHRNB, CMS1D, CMS2A, SCCMS) (MaxLight 550)
MBS6411664-02 5x 0.1 mL

CHRNB1 (Cholinergic Receptor, Nicotinic, beta (muscle), ACHRB, Acetylcholine Receptor Subunit beta, CHRNB, CMS1D, CMS2A, SCCMS) (MaxLight 550)

Sign In for Pricing
View Details
pLV3-CMV-AMH-3×FLAG-CopGFP-Puro Plasmid
PVT50898 2 µg

pLV3-CMV-AMH-3×FLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Mouse TYROBP (TYRO Protein Tyrosine Kinase Binding Protein) ELISA Kit
ELK0826-01 48 Tests

Mouse TYROBP (TYRO Protein Tyrosine Kinase Binding Protein) ELISA Kit

Sign In for Pricing
View Details