Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3G Rabbit Polyclonal Antibody (FITC)

APOBEC3G Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1

UniProt

Q9HC16

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_068594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mmp8 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3834503 1.0 µg DNA

Mmp8 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-NFkB-p65 (phospho-S536) RELA Antibody
A00284S536-1 100 µL

Anti-NFkB-p65 (phospho-S536) RELA Antibody

Sign In for Pricing
View Details
Dendroaspis Natriuretic Peptide
orb1942184-01 5 mg

Dendroaspis Natriuretic Peptide

Sign In for Pricing
View Details
Dendroaspis Natriuretic Peptide
orb1942184-02 50 mg

Dendroaspis Natriuretic Peptide

Sign In for Pricing
View Details
Recombinant Sulfolobus tokodaii Cytochrome P450 119 (cyp119)
MBS1435733-01 0.02 mg (E-Coli)

Recombinant Sulfolobus tokodaii Cytochrome P450 119 (cyp119)

Sign In for Pricing
View Details
Recombinant Sulfolobus tokodaii Cytochrome P450 119 (cyp119)
MBS1435733-02 0.02 mg (Yeast)

Recombinant Sulfolobus tokodaii Cytochrome P450 119 (cyp119)

Sign In for Pricing
View Details