Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3G Rabbit Polyclonal Antibody (HRP)

APOBEC3G Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1

UniProt

Q9HC16

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_068594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sprouty 4 (SPRY4) activation kit by CRISPRa
GA113132 1 Kit

Human Sprouty 4 (SPRY4) activation kit by CRISPRa

Sign In for Pricing
View Details
CD163 (Monocyte & Macrophage Marker) (M130/2162), CF740 conjugate, 0.1mg/mL
BNC742162-500 1x 500 µL

CD163 (Monocyte & Macrophage Marker) (M130/2162), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD52 (Epididymis-Specific Protein 5) (CD52/2276R), 0.2mg/mL
BNUB2276-500 1x 500 µL

CD52 (Epididymis-Specific Protein 5) (CD52/2276R), 0.2mg/mL

Sign In for Pricing
View Details
Human 5HT3E (HTR3E) activation kit by CRISPRa
GA117205 1 Kit

Human 5HT3E (HTR3E) activation kit by CRISPRa

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF640R conjugate, 0.1mg/mL
BNC400821-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820 + h-CALD), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF647 conjugate, 0.1mg/mL
BNC471796-100 1x 100 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details