Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3G Rabbit Polyclonal Antibody (HRP)

APOBEC3G Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

A3G, ARCD, ARP9, ARP-9, CEM15, CEM-15, MDS019, bK150C2.7, dJ494G10.1

UniProt

Q9HC16

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC3G

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC

Field of Research

Infectious Disease & Virology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_068594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Nose
CS802023 5x 5 µm

Tissue FFPE Sections, Nose

Sign In for Pricing
View Details
PBP (PEBP1) Human Gene Knockout Kit (CRISPR)
KN206355 1 Kit

PBP (PEBP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CC2D1A Rabbit Polyclonal Antibody
TA372184 100 µL

CC2D1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), CF488A conjugate, 0.1mg/mL
BNC881879-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/796), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Claudin 5 (CLDN5) (NM_003277) Human Over-expression Lysate
LC401129 20 µg

Claudin 5 (CLDN5) (NM_003277) Human Over-expression Lysate

Sign In for Pricing
View Details
Esomeprazole-d3 Sodium Salt
TRC-E668302-1MG 1 mg

Esomeprazole-d3 Sodium Salt

Sign In for Pricing
View Details