Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF189 Rabbit Polyclonal Antibody (HRP)

ZNF189 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

O75820

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF189

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KSFSQQRSLVNHQKIHAEVKTQETHECDACGEAFNCRISLIQHQKLHTAW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OLFR936 Adenovirus (Mouse)
33561054 1.0 mL

OLFR936 Adenovirus (Mouse)

Sign In for Pricing
View Details
ITGA2 (CD49b, Integrin alpha-2, CD49 Antigen-like Family Member B, Collagen Receptor, Platelet Membrane Glycoprotein Ia, GPIa, VLA-2 Subunit alpha, CD49B) (MaxLight 405)
MBS6190776-01 0.1 mL

ITGA2 (CD49b, Integrin alpha-2, CD49 Antigen-like Family Member B, Collagen Receptor, Platelet Membrane Glycoprotein Ia, GPIa, VLA-2 Subunit alpha, CD49B) (MaxLight 405)

Sign In for Pricing
View Details
ITGA2 (CD49b, Integrin alpha-2, CD49 Antigen-like Family Member B, Collagen Receptor, Platelet Membrane Glycoprotein Ia, GPIa, VLA-2 Subunit alpha, CD49B) (MaxLight 405)
MBS6190776-02 5x 0.1 mL

ITGA2 (CD49b, Integrin alpha-2, CD49 Antigen-like Family Member B, Collagen Receptor, Platelet Membrane Glycoprotein Ia, GPIa, VLA-2 Subunit alpha, CD49B) (MaxLight 405)

Sign In for Pricing
View Details
PMF-1 CRISPR/Cas9 KO Plasmid (m)
sc-426339 20 µg

PMF-1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
GRM2 (Glutamate Receptor Homolog, GPRC1B, MGlu2, Metabotropic, GLUR2, MGLUR2)
170823 50 µg

GRM2 (Glutamate Receptor Homolog, GPRC1B, MGlu2, Metabotropic, GLUR2, MGLUR2)

Sign In for Pricing
View Details
Anti-REG3A Antibody (C-term)
A05686-2-80ul 80 µL

Anti-REG3A Antibody (C-term)

Sign In for Pricing
View Details