Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF205 Rabbit Polyclonal Antibody (HRP)

ZNF205 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RhitH, Zfp13, ZNF210

UniProt

O95201

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZN205

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LSREEWGRLDHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHGKGEASG

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

XP_005255615

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FXYD1 (Phospholemman , FXYD domain containing ion transport regulator 1) discontinued
316524 100 µL

FXYD1 (Phospholemman , FXYD domain containing ion transport regulator 1) discontinued

Sign In for Pricing
View Details
CD45.1 Mouse Monoclonal Antibody (FITC)
orb1293896-01 25 assay

CD45.1 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
CD45.1 Mouse Monoclonal Antibody (FITC)
orb1293896-02 100 assay

CD45.1 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
Recombinant Pelagibacter ubique Thiazole synthase (thiG)
MBS1417848-01 0.02 mg (E-Coli)

Recombinant Pelagibacter ubique Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Pelagibacter ubique Thiazole synthase (thiG)
MBS1417848-02 0.1 mg (E-Coli)

Recombinant Pelagibacter ubique Thiazole synthase (thiG)

Sign In for Pricing
View Details
Recombinant Pelagibacter ubique Thiazole synthase (thiG)
MBS1417848-03 0.02 mg (Yeast)

Recombinant Pelagibacter ubique Thiazole synthase (thiG)

Sign In for Pricing
View Details