Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF217 Rabbit Polyclonal Antibody (Biotin)

ZNF217 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZABC1

UniProt

O75362

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF217

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SQTFTHSEDLNKHVLMQHRPTLCEPAVLRVEAEYLSPLDKSQVRTEPPKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ap1m1 Mouse shRNA Lentiviral Particle (Locus ID 11767)
TL510840V 500 µL Each

Ap1m1 Mouse shRNA Lentiviral Particle (Locus ID 11767)

Sign In for Pricing
View Details
Mouse Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit
RDR-FcgRI-Mu-01 96 Tests

Mouse Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit

Sign In for Pricing
View Details
Mouse Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit
RDR-FcgRI-Mu-02 48 Tests

Mouse Receptor I For The Fc Region Of Immunoglobulin G (FcgRI) ELISA Kit

Sign In for Pricing
View Details
MYL7 CRISPR Knock Out 293T Cell Line (Human)
31258141 1x 10^6 Cells / 1.0 mL

MYL7 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
CCL2 (Chemokine (C-C Motif) Ligand 2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, MGC9434, SCYA2, SMC-CF) (MaxLight 550)
244312-ML550 100 µL

CCL2 (Chemokine (C-C Motif) Ligand 2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, MGC9434, SCYA2, SMC-CF) (MaxLight 550)

Sign In for Pricing
View Details
CD40 Biosimilar Antibody
orb3182378-01 100 µg

CD40 Biosimilar Antibody

Sign In for Pricing
View Details