Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF236 Rabbit Polyclonal Antibody (FITC)

ZNF236 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF236A, ZNF236B

UniProt

Q9UL36

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF236

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

204kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_031371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR3GL, ID (POLR3GL, DNA-directed RNA polymerase III subunit RPC7-like, DNA-directed RNA polymerase III subunit G-like) (Azide free) (HRP)
MBS6335822-01 0.2 mL

POLR3GL, ID (POLR3GL, DNA-directed RNA polymerase III subunit RPC7-like, DNA-directed RNA polymerase III subunit G-like) (Azide free) (HRP)

Sign In for Pricing
View Details
POLR3GL, ID (POLR3GL, DNA-directed RNA polymerase III subunit RPC7-like, DNA-directed RNA polymerase III subunit G-like) (Azide free) (HRP)
MBS6335822-02 5x 0.2 mL

POLR3GL, ID (POLR3GL, DNA-directed RNA polymerase III subunit RPC7-like, DNA-directed RNA polymerase III subunit G-like) (Azide free) (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Tmeff1 shRNA (UAS) - Lentiviral mouse Tmeff1 shRNA (UAS) (25)
GTR15235853 1 Vial

Lentiviral mouse Tmeff1 shRNA (UAS) - Lentiviral mouse Tmeff1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Galanin Receptor 4 (GALR4), Recombinant, Rat, His-Tag, GST-Tag
050630-01 10 µg

Galanin Receptor 4 (GALR4), Recombinant, Rat, His-Tag, GST-Tag

Sign In for Pricing
View Details
Galanin Receptor 4 (GALR4), Recombinant, Rat, His-Tag, GST-Tag
050630-02 50 µg

Galanin Receptor 4 (GALR4), Recombinant, Rat, His-Tag, GST-Tag

Sign In for Pricing
View Details
Galanin Receptor 4 (GALR4), Recombinant, Rat, His-Tag, GST-Tag
050630-03 100 µg

Galanin Receptor 4 (GALR4), Recombinant, Rat, His-Tag, GST-Tag

Sign In for Pricing
View Details