Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF236 Rabbit Polyclonal Antibody (Biotin)

ZNF236 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF236A, ZNF236B

UniProt

Q9UL36

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF236

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

204kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_031371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

UHRF1BP1L, ID (UHRF1BP1L, KIAA0701, UHRF1-binding protein 1-like) (APC) discontinued
043590-APC 200 µL

UHRF1BP1L, ID (UHRF1BP1L, KIAA0701, UHRF1-binding protein 1-like) (APC) discontinued

Sign In for Pricing
View Details
Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)
MBS2099440-01 5x 96 Tests

Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)
MBS2099440-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)
MBS2099440-03 10x 96 Tests

Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)
MBS2099440-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Inducible T-Cell Co Stimulator Ligand (ICOSLG) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
PLV3-CMV-Circ0056654-CopGFP-Puro Plasmid
PVT70694 2 µg

PLV3-CMV-Circ0056654-CopGFP-Puro Plasmid

Sign In for Pricing
View Details