Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhe41 Rabbit Polyclonal Antibody (HRP)

Bhlhe41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dec2, Bhlhb3, Sharp1, SHARP-1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_001074956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sterol regulatory element-binding protein 1A (SREBP-1A) Rat ELISA Kit
H3293 96 Tests

Sterol regulatory element-binding protein 1A (SREBP-1A) Rat ELISA Kit

Sign In for Pricing
View Details
FLT1 Antibody
BF0131-01 50 µL

FLT1 Antibody

Sign In for Pricing
View Details
FLT1 Antibody
BF0131-02 100 µL

FLT1 Antibody

Sign In for Pricing
View Details
FLT1 Antibody
BF0131-03 200 µL

FLT1 Antibody

Sign In for Pricing
View Details
BMX Rabbit Polyclonal Antibody (APC-Cy7)
orb2434996 100 µL

BMX Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
RNF149 Protein Vector (Mouse) (pPM-C-His)
PV224713 500 ng

RNF149 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details