Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhe41 Rabbit Polyclonal Antibody (HRP)

Bhlhe41 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dec2, Bhlhb3, Sharp1, SHARP-1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_001074956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PTEN Antibody Picoband® (Dylight488 Conjugate)
A00006-1-Dylight488 100 µg

Anti-PTEN Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
25ml, Cell G Surface-treated, w/vent cap, Dnase/Rnase-free, Non-pyrogenic, Sterilized (10/pkg,50/inner box,200/cs)
CELCUJGF012025A 200 Pieces/Case:10 Pieces/ PACKS:20 PACKS/CASE

25ml, Cell G Surface-treated, w/vent cap, Dnase/Rnase-free, Non-pyrogenic, Sterilized (10/pkg,50/inner box,200/cs)

Sign In for Pricing
View Details
ATP13A2 Polyclonal Conjugated Antibody
orb1628329 100 µL

ATP13A2 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
ApoL1 Polyclonal Antibody
orb310147-01 50 μL

ApoL1 Polyclonal Antibody

Sign In for Pricing
View Details
ApoL1 Polyclonal Antibody
orb310147-02 100 µL

ApoL1 Polyclonal Antibody

Sign In for Pricing
View Details
Alpha-Glutamylthymine
T29896-01 25 mg

Alpha-Glutamylthymine

Sign In for Pricing
View Details