Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bhlhe41 Rabbit Polyclonal Antibody (Biotin)

Bhlhe41 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dec2, Bhlhb3, Sharp1, SHARP-1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QLLEHRDFIGLDYSSLYMCKPKRSLKRDDTKDTYKLPHRLIEKKRRDRIN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

XP_001074956

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Caenorhabditis elegans Putative RIO-type serine/threonine-protein kinase 3 (riok-3), partial
MBS1100403 Inquire

Recombinant Caenorhabditis elegans Putative RIO-type serine/threonine-protein kinase 3 (riok-3), partial

Sign In for Pricing
View Details
GCMA Polyclonal Antibody, Cy7 Conjugated
bs-6306R-Cy7 100 µL

GCMA Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
2-Hydroxyisobutyryl-Histone H3 (Lys14) Rabbit Monoclonal Antibody
AG3819 50 µL

2-Hydroxyisobutyryl-Histone H3 (Lys14) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Sphingomyelin Synthase-Related Protein 1 (SAMD8) Antibody
abx026570-01 80 µL

Sphingomyelin Synthase-Related Protein 1 (SAMD8) Antibody

Sign In for Pricing
View Details
Sphingomyelin Synthase-Related Protein 1 (SAMD8) Antibody
abx026570-02 400 µL

Sphingomyelin Synthase-Related Protein 1 (SAMD8) Antibody

Sign In for Pricing
View Details
AMPK alpha 1 Antibody
MBS8584281-01 0.1 mL

AMPK alpha 1 Antibody

Sign In for Pricing
View Details