Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ23436 Rabbit Polyclonal Antibody (Biotin)

FLJ23436 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q9H5H4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ23436

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPESPGFESRSPGLVPPSPEFAPRSPESDSQSPEFESQSPRYEPQSPGYE

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_078947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMTNL2 Protein Vector (Human) (pPM-C-His)
PV130481 500 ng

SMTNL2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Cbx6 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3613804 1.0 µg DNA

Cbx6 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Conjugated INPP4B Rabbit mAb
C59032 100 µL

Conjugated INPP4B Rabbit mAb

Sign In for Pricing
View Details
FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (MaxLight 550)
246324-ML550 100 µL

FOXO3A (Forkhead Box O3, AF6q21, DKFZp781A0677, FKHRL1, FKHRL1P2, FOXO2, FOXO3A, MGC12739, MGC31925) (MaxLight 550)

Sign In for Pricing
View Details
Ethyl 2- (diethoxyphosphoryl) -3-methylbutanoate-d7
HY-W710856 1 Each

Ethyl 2- (diethoxyphosphoryl) -3-methylbutanoate-d7

Sign In for Pricing
View Details
GDF8 Rabbit Polyclonal Antibody (RBITC)
orb1052746 100 µL

GDF8 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details