Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF408 Rabbit Polyclonal Antibody (HRP)

ZNF408 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVR6, RP72

UniProt

Q9H9D4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF408

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FKAHMLGHRGVRPFPCPQCDKAYGTQRDLKEHQVVHSGARPFACDQCGKA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079017

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100365532 3'UTR GFP Stable Cell Line
TU259550 1.0 mL

LOC100365532 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Retinoic Acid Receptor gamma (RARG) (NM_001042728) Human Tagged ORF Clone Lentiviral Particle
RC212687L3V 200 µL

Retinoic Acid Receptor gamma (RARG) (NM_001042728) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Fetuin A/AHSG Polyclonal Antibody, PE-Cy7 Conjugated
bs-2922R-PE-Cy7-TR 20 µL

Fetuin A/AHSG Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Xpress™ Human NEO1 Over-expressing Stable Cell Line
ABC-X2033 1 Vial

Xpress™ Human NEO1 Over-expressing Stable Cell Line

Sign In for Pricing
View Details
Phospho-PSD95 (Tyr236 + Tyr240) Polyclonal Antibody, APC-Cy7 Conjugated
bs-3349R-APC-Cy7 100 µL

Phospho-PSD95 (Tyr236 + Tyr240) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
3L, Vent Cap, PC, Sterile
CELCUFG043003S 12 Pieces/Case:1 Piece/ PACKS:12 PACKS/CASE

3L, Vent Cap, PC, Sterile

Sign In for Pricing
View Details