Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF408 Rabbit Polyclonal Antibody (HRP)

ZNF408 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVR6, RP72

UniProt

Q9H9D4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF408

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FKAHMLGHRGVRPFPCPQCDKAYGTQRDLKEHQVVHSGARPFACDQCGKA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

78kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079017

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tectorigenin, 7-O-[?-D-Apiofuranosyl-(1-6)-?-D-glu
MBS5790433 Inquire

Tectorigenin, 7-O-[?-D-Apiofuranosyl-(1-6)-?-D-glu

Sign In for Pricing
View Details
Lentiviral human ZFHX2 shRNA (UAS) - Lentiviral human ZFHX2 shRNA (UAS, RFP) plasmid
GTR15325516 1 Vial

Lentiviral human ZFHX2 shRNA (UAS) - Lentiviral human ZFHX2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
SLU7, NT (SLU7, Pre-mRNA-splicing factor SLU7) (MaxLight 490) discontinued
042016-ML490 100 µL

SLU7, NT (SLU7, Pre-mRNA-splicing factor SLU7) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Monkey Thymus cDNA, Cynomolgus
KD-702 30 Reactions

Monkey Thymus cDNA, Cynomolgus

Sign In for Pricing
View Details
ACSM1 ORF Vector (Human) (pORF)
ORF012139 1.0 µg DNA

ACSM1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
CPLA2 Rabbit Polyclonal Antibody (BF594)
orb2461893 100 µL

CPLA2 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details