Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZBTB3 Rabbit Polyclonal Antibody (FITC)

ZBTB3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZBTB3

UniProt

Q9H5J0

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZBTB3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GTMEFPEHSQQLLQSLREQRSQGFLCDCTVMVGSTQFLAHRAVLASCSPF

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079060

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGG (Fibrinogen gamma Chain)
246104 100 µg

FGG (Fibrinogen gamma Chain)

Sign In for Pricing
View Details
Human Suppressor of cytokine signaling 3 ELISA Kit
orb1659511 96 Tests

Human Suppressor of cytokine signaling 3 ELISA Kit

Sign In for Pricing
View Details
Human TNR1A protein (Active)
orb359206-01 5 µg

Human TNR1A protein (Active)

Sign In for Pricing
View Details
Human TNR1A protein (Active)
orb359206-02 100 µg

Human TNR1A protein (Active)

Sign In for Pricing
View Details
Human TNR1A protein (Active)
orb359206-03 500 µg

Human TNR1A protein (Active)

Sign In for Pricing
View Details
COL12, NT (COLEC12, CLP1, NSR2, SCARA4, SRCL, Collectin-12, Collectin placenta protein 1, Nurse cell scavenger receptor 2, Scavenger receptor class A member 4, Scavenger receptor with C-type lectin) (MaxLight 490)
MBS6287576-01 0.1 mL

COL12, NT (COLEC12, CLP1, NSR2, SCARA4, SRCL, Collectin-12, Collectin placenta protein 1, Nurse cell scavenger receptor 2, Scavenger receptor class A member 4, Scavenger receptor with C-type lectin) (MaxLight 490)

Sign In for Pricing
View Details