Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbll1 Rabbit Polyclonal Antibody (FITC)

Cbll1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ha, Hakai, c-Cbl-l, AI467391, c-Cbl-like

UniProt

Q9JIY2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPVTAPPPHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_598809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX3 Antibody
orb1327343 100 µg

TBX3 Antibody

Sign In for Pricing
View Details
Human SCP2D1-AS1 Pre-designed siRNA Set B
SI014389B 1 Each

Human SCP2D1-AS1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Polyclonal Antibody to Mannose Binding Lectin (MBL)
TRV-0051287-01 20 µL

Polyclonal Antibody to Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details
Polyclonal Antibody to Mannose Binding Lectin (MBL)
TRV-0051287-02 100 µL

Polyclonal Antibody to Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details
Polyclonal Antibody to Mannose Binding Lectin (MBL)
TRV-0051287-03 200 µL

Polyclonal Antibody to Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details
Polyclonal Antibody to Mannose Binding Lectin (MBL)
TRV-0051287-04 1 mL

Polyclonal Antibody to Mannose Binding Lectin (MBL)

Sign In for Pricing
View Details