Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cbll1 Rabbit Polyclonal Antibody (HRP)

Cbll1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ha, Hakai, c-Cbl-l, AI467391, c-Cbl-like

UniProt

Q9JIY2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPVTAPPPHHYNPNSLPQFTEDQGTLSPPFTQPGGMSPGIWPAPRGPPPP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_598809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human UCHL1 protein (GST tag)
PDEH100126-01 20 µg

Recombinant Human UCHL1 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human UCHL1 protein (GST tag)
PDEH100126-02 100 µg

Recombinant Human UCHL1 protein (GST tag)

Sign In for Pricing
View Details
MAN1B1 Rabbit pAb, PE-Cy5.5 conjugated
orb2877039 100 µL

MAN1B1 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
HEXIM1 (hexamethylene bis-acetamide Inducible 1, CLP1, EDG1, FLJ13562, HIS1, MAQ1) (MaxLight 550)
247032-ML550 100 µL

HEXIM1 (hexamethylene bis-acetamide Inducible 1, CLP1, EDG1, FLJ13562, HIS1, MAQ1) (MaxLight 550)

Sign In for Pricing
View Details
Human CYP3A4,Low-Reductase
HY-E70464 Inquire

Human CYP3A4,Low-Reductase

Sign In for Pricing
View Details
PCMV-HA-Aqp4 (rat) -Neo
BZ59796 1 Vial

PCMV-HA-Aqp4 (rat) -Neo

Sign In for Pricing
View Details