Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBLL1 Rabbit Polyclonal Antibody (Biotin)

CBLL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HAKAI, RNF188

UniProt

Q75N03

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBLL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDHTDNELQGTNSSGSLGGLDVRRRIPIKLISKQANKAKPAPRTQRTINR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079090

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(Des-Thr7) -Glucagon
HY-P4504 1 Each

(Des-Thr7) -Glucagon

Sign In for Pricing
View Details
IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO)
247380 100 µg

IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO)

Sign In for Pricing
View Details
PIGV Protein Vector (Rat) (pPM-C-His)
PV294013 500 ng

PIGV Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
MED1 (Mediator of RNA Polymerase II Transcription Subunit 1, Activator-recruited Cofactor 205kD Component, ARC205, Mediator Complex Subunit 1, Peroxisome Proliferator-activated Receptor-binding Protein, PBP, PPAR-binding Protein, Thyroid Hormone Receptor-associated Protein Complex 220kD Component, Trap220, Thyroid Receptor-interacting Protein 2, TR-interacting Protein 2, TRIP-2, Vitamin D Receptor-interacting Protein Complex Component DRIP205, p53 Regulatory Protein RB18A, ARC205, CRSP1, CRSP200, DRIP205, DRIP230, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (Biotin)
129537-Biotin 100 µL

MED1 (Mediator of RNA Polymerase II Transcription Subunit 1, Activator-recruited Cofactor 205kD Component, ARC205, Mediator Complex Subunit 1, Peroxisome Proliferator-activated Receptor-binding Protein, PBP, PPAR-binding Protein, Thyroid Hormone Receptor-associated Protein Complex 220kD Component, Trap220, Thyroid Receptor-interacting Protein 2, TR-interacting Protein 2, TRIP-2, Vitamin D Receptor-interacting Protein Complex Component DRIP205, p53 Regulatory Protein RB18A, ARC205, CRSP1, CRSP200, DRIP205, DRIP230, PBP, PPARBP, PPARGBP, RB18A, TRAP220, TRIP2) (Biotin)

Sign In for Pricing
View Details
ARHGEF2 Antibody
CSB-PA889734-01 50 μL

ARHGEF2 Antibody

Sign In for Pricing
View Details
ARHGEF2 Antibody
CSB-PA889734-02 100 µL

ARHGEF2 Antibody

Sign In for Pricing
View Details