Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF212 Rabbit Polyclonal Antibody (FITC)

ZNF212 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF182, ZNFC150, C2H2-150

UniProt

Q9UDV6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF212

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGPSAGQHVQERFSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_036388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Replacement Battery
P6080-BA 1 Each

Replacement Battery

Sign In for Pricing
View Details
VSIG2 Rabbit Polyclonal Antibody
TA385555 100 µL

VSIG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD177 (NM_020406) Human Recombinant Protein
TP306463M 100 µg

CD177 (NM_020406) Human Recombinant Protein

Sign In for Pricing
View Details
FOXA1 / HNF3A (rFOXA1/1515), CF640R conjugate, 0.1mg/mL
BNC402305-500 1x 500 µL

FOXA1 / HNF3A (rFOXA1/1515), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ass1 Mouse Gene Knockout Kit (CRISPR)
KN501698 1 Kit

Ass1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Histone H3 (mono methyl K9) Antibody
RC-16660-01 50 μL

Recombinant Histone H3 (mono methyl K9) Antibody

Sign In for Pricing
View Details